Shenzhen JYMed Technology Co.,Ltd -Professional Peptide Manufacture

  • Home
  • China
  • Shenzhen
  • Shenzhen JYMed Technology Co.,Ltd -Professional Peptide Manufacture

Shenzhen JYMed Technology Co.,Ltd -Professional Peptide Manufacture Shenzhen JYMed Technology Co.,Ltd is high-tech enterprise engaged in research and development, manufacture and commercialization of peptides based products

【Our featured peptide products】
Oxytocin,Terlipressin, Atosiban,Vasopressin,Bivalirudin, Buserelin Acetate,Caspofungin Acetate,Carbetocin ,Desmopressin Acetate,Goserelin Acetate,Leuprorelin Acetate etc. and some intermediates, cosmetic peptide. Has CRO and CMO rich experience. If interested in our company,contact yancey directly:
【Email:[email protected]; Tel / whatsapp/wechat:+8615013529272】


【Why Chose JYM】
1.R&D Innovation:New peptide drug process development and process optimization
2.GMP Production:cGMP manufacturing plant covering 30, 000 square meters
3.Excellent Service:
Wide variety of quality peptides
Timely product delivery
After product sale services
4.QualityAssuarance:
Stringent QA and QC system
Modern analytical instrument: LC-MS, NMR (Contract), HPLC&GC, IR, UV etc.

【CRO&CMO】
JYM provides synthetic peptides and related services with various labels, modifications, scales, purities profiles and delivery time options to meet your needs
Range of services
Large scale cGMP manufacture of commercial materials
Syntheses ranging from gram to kilogram scale
Multiple disulfide bridges sytnhesis
Cyclized peptides synthesis
Phosphorylated/Biotinylated peptide modification
Peptide modification with C-terminal or N-terminal;
Purity from crude to 99% based on your needs
Solid Phase/Solution/Segment Coupling Technologies

Since we offer CRO and CMO service, we have assisted our clients in their NDA, INDA, ANDA projects, we have significant experience in developing peptide API and peptide finish dosage, we would like to support you in this project per your requirement.

How many you know about  ?  and   are   acid polymers. Peptides are short amino acid chains. The name peptide is coming ...
15/04/2019

How many you know about ?
and are acid polymers. Peptides are short amino acid chains. The name peptide is coming from pepton [peptos: digested (Greek)]. Naturally occurring human peptides are known for cellular communication, such as protein regulation, cell proliferation, cell migration, inflammation, angiogenesis, and melanogenesis , which results in a broad variety of physiological processes including defense, immunity, stress, growth, homeostasis, and reproduction .

  north america # Welcome to meet you at JYMed Booth NO.1946. JYMed is a professional manufacuter and dedicate to provid...
27/03/2019

north america # Welcome to meet you at JYMed Booth NO.1946. JYMed is a professional manufacuter and dedicate to providing peptide APIs, peptide cosmetic ingrendients and CRO&CMO service.

Team work
31/08/2018

Team work

We cordially invite you to visit our booth  at CPHI worldwide Spain Contact: YanceyEmail:yancey@jymedtech.comOur Booth N...
23/08/2018

We cordially invite you to visit our booth at CPHI worldwide Spain
Contact: Yancey
Email:[email protected]
Our Booth NO: 6G25

We cordially invite you to visit our booth at Tides 2018:Place: Hynes Convention Center,Boston, MA.On May 7-10Contact: Y...
21/04/2018

We cordially invite you to visit our booth at Tides 2018:
Place: Hynes Convention Center,Boston, MA.On May 7-10
Contact: Yancey
Email:[email protected]
Our Booth NO: 428

We cordially invite you to visit our booth:Place:CPhI North America, April 24-26, 2018,Philadelphia, PA, USAContact Emai...
21/04/2018

We cordially invite you to visit our booth:
Place:CPhI North America, April 24-26, 2018,Philadelphia, PA, USA
Contact Email:[email protected]
Our Booth NO: 285

15/01/2018

Teduglutide /cas 197922-42-2

CAS #:197922-42-2
Sequence:HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
Molecular formula:C164H252N44O55S1
Molecular weight:3752.13

04/08/2017

Plecanatide Acetate| 467426-54-6
molecular formula:c65h104n18o26s4
molecular weight: 1681.88626 g/mol
sequence: h-asn-asp-glu-cys(1)-glu-leu-cys(2)-val-asn-val-ala-cys(1)-thr-gly-cys(2)-leu-oh

Contact: [email protected]

There was never a night or a problem that could defeat sunrise or hope. — Bernard Williams
25/07/2017

There was never a night or a problem that could defeat sunrise or hope. — Bernard Williams

Every morning you have two choices- continue to sleep with dreams or wake up and chase your dreams. The choice is yours!...
24/07/2017

Every morning you have two choices- continue to sleep with dreams or wake up and chase your dreams. The choice is yours!😏

31/05/2017
31/05/2017

【Our featured peptide products】
Oxytocin,Terlipressin, Atosiban,Vasopressin,Bivalirudin, Buserelin Acetate,Caspofungin Acetate,Carbetocin ,Desmopressin Acetate,Goserelin Acetate,Leuprorelin Acetate etc. and some intermediates, cosmetic peptide. Has CRO and CMO rich experience.
If interested in our company,contact yancey directly:
【Email:[email protected]; Tel / whatsapp/wechat:+8615013529272】

Address

深圳市南山区高新中一道10号
Shenzhen
518000

Alerts

Be the first to know and let us send you an email when Shenzhen JYMed Technology Co.,Ltd -Professional Peptide Manufacture posts news and promotions. Your email address will not be used for any other purpose, and you can unsubscribe at any time.

Contact The Business

Send a message to Shenzhen JYMed Technology Co.,Ltd -Professional Peptide Manufacture:

Share